PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA93G00066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 377aa    MW: 41936 Da    PI: 6.5149
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA93G00066genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-10159216562
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 k+++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  AA93G00066 159 KKAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 216
                 89****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16155219IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507157220IPR004827Basic-leucine zipper domain
PfamPF001703.4E-9159217IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.94E-10159213No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-10159214No hitNo description
CDDcd147035.06E-22160209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MEDPSNTKSN QSNQNRPQCP TPPLTNPSPT PSLTPFRGPY HRRAHSEVQF RLPEDLDLSE  60
PFGGFDELGS EDDLFCSYMD IENLGSGSVS DSVGPSAAPR SDNLFSAENG SGGGDEAGNS  120
RPRHRHSLSV DGSSTLESIE AKKAMAPDKL AELWVVDPKK AKRIIANRQS AARSKERKAR  180
YILELERKVQ TLQTEATTLS AQLSLFQRDT TGLSSENTEL KLRLQVMEHQ AKLRDALNDQ  240
LKKEVDRLKY ATGEVSASDA YNLGMAQHMQ YSQQPSQSFF QHHQQQQQQI ALADAQNLQQ  300
MTHQFHLFQP NNNNNNNITS SNRLQQPHQL MNSTQSHQFS DVKREDPLGR LQGLDISSCN  360
RGGSNFGRSD SVSESSS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010505811.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P42e-93RF2B_ORYSJ; Transcription factor RF2b
TrEMBLV4MJI30.0V4MJI3_EUTSA; Uncharacterized protein
STRINGAT2G40620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-170bZIP family protein